The Filament domain within your query sequence starts at position 198 and ends at position 511, and its E-value is 4.22e-152.

QEREQIKTLNNKFASFIDKVRFLEQQNQVLRTKWELLQQLDVGSRTTNLDPIFQAYIGMLKKQVDRLSAERTSQESELNNMQDLVEDFKKKYEDEINKRTSAENDFVTIKKDVDSCYMDKTELQARLDILAQEVNFLRTLYDAELSQLQQDVTDTNVILSMDNNRNLDLDSIIAEVQNQYEMIAHKSKAESEELYHSKYEELQVTAVKHGDSLKEIKMEISELNRTIQRLQGEISHVKKQCKGVQDSIADAEQRGEHAIKDARGKLTDLEEALQQCREDLARLLRDYQELMNTKLSLDVEIATYRKLLEGEECR
Filament

Filament

Intermediate filament protein
SMART ACC:SM001391
Description: -
InterPro ACC:IPR039008
InterPro abstract:

Intermediate filaments (IF) [ PUBMED:2183847 PUBMED:28101862 ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope. They generally form filamentous structures 8 to 14 nm wide. IF proteins are members of … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 20 668 Filament domains in 20 433 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Filament domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Filament domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the Filament domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Filament domain which could be assigned to a KEGG orthologous group, and not all proteins containing Filament domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamFilament
InterProIPR039008