The malic domain within your query sequence starts at position 89 and ends at position 270, and its E-value is 3.48e-98.

QERNEKLFYRILQDDIESLMPIVYTPTVGLACCQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIQPEKCLPVCIDVGTDNMALLKDPFYMGLYQKRDRSQLYDDLMDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYQ
malic

malic

Malic enzyme, N-terminal domain
SMART ACC:SM001274
Description: -
InterPro ACC:IPR012301
InterPro abstract:

This entry represents the N-terminal domain of the NAD(P)-dependent malic enzyme and related proteins from bacteria, eukaryotes and archaea.

Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate, a reaction important in a number of metabolic pathways - e.g. carbon dioxide released from the reaction may be used in sugar production during … expand

GO function:oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor (GO:0016616), malic enzyme activity (GO:0004470)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 30 325 malic domains in 30 291 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing malic domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing malic domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a malic domain which could be assigned to a KEGG orthologous group, and not all proteins containing malic domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfammalic
InterProIPR012301