The PAM domain within your query sequence starts at position 176 and ends at position 350, and its E-value is 1.08e-64.

QKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFI
PAM

PAM

PCI/PINT associated module
SMART ACC:SM000753
Description: -
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 0 PAM domains in 0 proteins in SMART's NRDB database.

Relevant references for this domain

Primary literature for the PAM domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PAM domain which could be assigned to a KEGG orthologous group, and not all proteins containing PAM domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain