The GYF domain within your query sequence starts at position 528 and ends at position 583, and its E-value is 2.83e-26.

QKWYYKDPQGEIQGPFNNQEMAEWFQAGYFTMSLLVKRACDESFQPLGDIMKMWGR
GYF

GYF

Contains conserved Gly-Tyr-Phe residues
SMART ACC:SM000444
Description:Proline-binding domain in CD2-binding protein. Contains conserved Gly-Tyr-Phe residues.
InterPro ACC:IPR003169
InterPro abstract:

The glycine-tyrosine-phenylalanine (GYF) domain is an around 60-amino acid domain which contains a conserved GP[YF]xxxx[MV]xxWxxx[GN]YF motif. It was identified in the human intracellular protein termed CD2 binding protein 2 (CD2BP2), which binds to a site containing two tandem PPPGHR segments within the cytoplasmic region of CD2. Binding experiments and mutational analyses have demonstrated … expand

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 194 GYF domains in 1 181 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing GYF domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing GYF domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the GYF domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a GYF domain which could be assigned to a KEGG orthologous group, and not all proteins containing GYF domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003169