The FGF domain within your query sequence starts at position 51 and ends at position 178, and its E-value is 1.29e-43.

QLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRY
FGF

FGF

Acidic and basic fibroblast growth factor family.
SMART ACC:SM000442
Description:Mitogens that stimulate growth or differentiation of cells of mesodermal or neuroectodermal origin. The family play essential roles in patterning and differentiation during vertebrate embryogenesis, and have neurotrophic activities.
InterPro ACC:IPR002209
InterPro abstract:

Fibroblast growth factors (FGFs) [ PUBMED:2549857 PUBMED:3072709 ] are a family of multifunctional proteins, often referred to as 'promiscuous growth factors' due to their diverse actions on multiple cell types [ PUBMED:1705486 expand

GO function:growth factor activity (GO:0008083)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 823 FGF domains in 6 820 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing FGF domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing FGF domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the FGF domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a FGF domain which could be assigned to a KEGG orthologous group, and not all proteins containing FGF domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR002209
PROSITEHBGF_FGF
PfamFGF