The ZnF_C3H1 domain within your query sequence starts at position 243 and ends at position 276, and its E-value is 9.28e-1.

QYRSTPCPSVKHGDEWGEPSRCDGGDSCQYCHSR
ZnF_C3H1

ZnF_C3H1

zinc finger
SMART ACC:SM000356
Description: -
InterPro ACC:IPR000571
InterPro abstract:

This entry represents C-x8-C-x5-C-x3-H (CCCH) type Zinc finger (Znf) domains.

Proteins containing CCCH Znf domains include Znf proteins from eukaryotes involved in cell cycle or growth phase-related regulation, e.g. human TIS11B (butyrate response factor 1, also known as mRNA decay activator protein ZFP36L1), a probable regulatory protein involved in regulating the response to growth … expand

GO function:metal ion binding (GO:0046872)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 102 008 ZnF_C3H1 domains in 41 916 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ZnF_C3H1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ZnF_C3H1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the ZnF_C3H1 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ZnF_C3H1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing ZnF_C3H1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamzf-CCCH
InterProIPR000571