The VWD domain within your query sequence starts at position 825 and ends at position 988, and its E-value is 7.92e-40.

RCVGEGSATCQVSGASHYTTFDGRHFDFMGTCVHVLAQTCWTRPGLKPFTILQENAVQGNKQVSVTKKITIEVANYTLQLEQNQWKVKVNGVDMKLPVLLDEDRVQAFRHGTDMVIETKFGLLVSYDLKYSVRVKVPHNYYKHMCGLCGDYNDDPKNDFQKSDG
VWD

VWD

von Willebrand factor (vWF) type D domain
SMART ACC:SM000216
Description:Von Willebrand factor contains several type D domains: D1 and D2 are present within the N-terminal propeptide whereas the remaining D domains are required for multimerisation.
InterPro ACC:IPR001846
InterPro abstract:

Von Willebrand factor (VWF) is a large, multimeric blood glycoprotein synthesized in endothelial cells and megakaryocytes, that is required for normal hemostasis. Mutant forms are involved in the most common inherited bleeding disorder (von Willebrand disease: VWD). VWF mediates the adhesion of platelets to sites of vascular damage by binding to specific platelet membrane glycoproteins and to … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 25 698 VWD domains in 12 416 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing VWD domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing VWD domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the VWD domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the VWD domain.

ProteinDescriptionDisease / phenotype
VWF_HUMANOMIM:193400 : von Willebrand disease

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a VWD domain which could be assigned to a KEGG orthologous group, and not all proteins containing VWD domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001846
Pfamvwd