The SO domain within your query sequence starts at position 58 and ends at position 105, and its E-value is 1.68e-11.

RFGCCEARDDTCVTQFYEANALCYCDSFCERDTSDCCPDYKSFCHEEK
SO

SO

Somatomedin B -like domains
SMART ACC:SM000201
Description:Somatomedin-B is a peptide, proteolytically excised from vitronectin, that is a growth hormone-dependent serum factor with protease-inhibiting activity.
InterPro ACC:IPR001212
InterPro abstract:

Somatomedin B (SMB), a serum factor of unknown function, is a small cysteine-rich peptide, derived proteolytically from the N terminus of the cell-substrate adhesion protein vitronectin [ PUBMED:2447940 ]. Cys-rich somatomedin B-like domains are found in a number of proteins [ PUBMED:1710108 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 819 SO domains in 4 510 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SO domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SO domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the SO domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the SO domain.

ProteinDescriptionDisease / phenotype
ENPP1_HUMANOMIM:173335 : Ossification of posterior longitudinal ligament of spine
OMIM:602475 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SO domain which could be assigned to a KEGG orthologous group, and not all proteins containing SO domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITESO_DOMAIN
InterProIPR001212