The G_patch domain within your query sequence starts at position 148 and ends at position 194, and its E-value is 3.3e-18.

RHTKGIGQKLLQKMGYVPGRGLGKNAQGIINPIEAKQRKGKGAVGAY
G_patch

G_patch

glycine rich nucleic binding domain
SMART ACC:SM000443
Description:A predicted glycine rich nucleic binding domain found in the splicing factor 45, SON DNA binding protein and D-type Retrovirus- polyproteins.
InterPro ACC:IPR000467
InterPro abstract:

The G-patch domain is an approximately 48 amino acid domain, which is found in a single copy in several RNA-associated proteins and in type D retroviral polyproteins. It is widespread among eukaryotes but is absent in archaea and bacteria. The G-patch domain has been called after its most notable feature, the presence of six highly conserved glycine residues. The position following the first conserved … expand

GO function:nucleic acid binding (GO:0003676)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 21 210 G_patch domains in 20 996 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing G_patch domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing G_patch domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a G_patch domain which could be assigned to a KEGG orthologous group, and not all proteins containing G_patch domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000467
PfamG-patch