The TECPR domain within your query sequence starts at position 898 and ends at position 931, and its E-value is 1.79e-1.

RHWYEALPQAVFVALSDDTAWIIRTNGDLYLQTG
TECPR

TECPR

Beta propeller repeats in Physarum polycephalum tectonins, Limulus lectin L-6 and animal hypothetical proteins.
SMART ACC:SM000706
Description: -
InterPro ACC:IPR006624
InterPro abstract:

Tectonins I and II are two dominant proteins in the nuclei and nuclear matrix from plasmodia of Physarum polycephalum (Slime mold) which encode 217 and 353 amino acids, respectively. Tectonin I is homologous to the C-terminal two-thirds of tectonin II. Both proteins contain six tandem repeats that are each 33-37 amino acids in length and define a new consensus sequence. Homologous repeats are … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 16 106 TECPR domains in 2 266 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing TECPR domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing TECPR domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the TECPR domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a TECPR domain which could be assigned to a KEGG orthologous group, and not all proteins containing TECPR domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006624