The ARM domain within your query sequence starts at position 400 and ends at position 440, and its E-value is 1.51e-4.

RKDQVEYLVQQNVIPPFCNLLSVKDSQVVQVVLDGLKNILI
ARM

ARM

Armadillo/beta-catenin-like repeats
SMART ACC:SM000185
Description:Approx. 40 amino acid repeat. Tandem repeats form superhelix of helices that is proposed to mediate interaction of beta-catenin with its ligands. Involved in transducing the Wingless/Wnt signal. In plakoglobin arm repeats bind alpha-catenin and N-cadherin.
InterPro ACC:IPR000225
InterPro abstract:

This entry represents proteins that contain the Armadillo repeat mainly from eukaryotes. These proteins include: Vacuolar protein 8, Importins, Catenins, Junction plakoglobin and related proteins.

The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in … expand

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 167 287 ARM domains in 29 030 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ARM domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ARM domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Protein-binding

Relevant references for this domain

Primary literature for the ARM domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ARM domain which could be assigned to a KEGG orthologous group, and not all proteins containing ARM domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000225
PfamArmadillo_seg