The FoP_duplication domain within your query sequence starts at position 165 and ends at position 241, and its E-value is 1.45e-4.

RPRPAQSRNRGGMPRNPGSGGYGGGGTRRETLGDSQGRGGTSSNSKKQQQQQQQQTQLSAEELDAQLDTYWEMMDTS

FoP_duplication C-terminal duplication domain of Friend of PRMT1
SMART ACC:	SM001218
Description:	Fop, or Friend of Prmt1, proteins are conserved from fungi and plants to vertebrates. There is little that is actually conserved except for this C-terminal LDXXLDAYM region where X is any amino acid). The Fop proteins themselves are nuclear proteins localised to regions with low levels of DAPI, with a punctate/speckle-like distribution. Fop is a chromatin-associated protein and it colocalises with facultative heterochromatin. It is is critical for oestrogen-dependent gene activation (PUBMED:19858291).
InterPro ACC:	IPR025715
InterPro abstract:	This LDXXLDAYM region (where X is any amino acid) is duplicated in the C terminus of chromatin target of PRMT1 protein (also known as Fop), which are chromatin-associated proteins that co-localise with facultative heterochromatin and are critical for oestrogen-dependent gene activation [ PUBMED:19858291 ]. The region … expand This LDXXLDAYM region (where X is any amino acid) is duplicated in the C terminus of chromatin target of PRMT1 protein (also known as Fop), which are chromatin-associated proteins that co-localise with facultative heterochromatin and are critical for oestrogen-dependent gene activation [ PUBMED:19858291 ]. The region also occurs in other proteins, including THO complex subunit 4 ( O08583 ) and RNA and export factor-binding protein 2 ( Q9JJW6 ). collapse
Family alignment:	View the Family alignment or the Alignment consensus sequence
There are 3 366 FoP_duplication domains in 3 361 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing FoP_duplication domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing FoP_duplication domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the FoP_duplication domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a FoP_duplication domain which could be assigned to a KEGG orthologous group, and not all proteins containing FoP_duplication domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfam	FoP_duplication
InterPro	IPR025715