The NH domain within your query sequence starts at position 43 and ends at position 120, and its E-value is 3.19e-50.

RQCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAVGICCSDESCVAEPEC
NH

NH

Neurohypophysial hormones
SMART ACC:SM000003
Description:Vasopressin/oxytocin gene family.
InterPro ACC:IPR000981
InterPro abstract:

Oxytocin and vasopressin are nine-residue, structurally and functionally related neurohypophysial peptide hormones. Oxytocin mediates contraction of the smooth muscle of the uterus and mammary gland, while vasopressin has antidiuretic action on the kidney, and mediates vasoconstriction of the peripheral vessels [ PUBMED:3147712 expand

GO component:extracellular region (GO:0005576)
GO function:neurohypophyseal hormone activity (GO:0005185)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 740 NH domains in 737 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing NH domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing NH domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the NH domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the NH domain.

ProteinDescriptionDisease / phenotype
NEU2_HUMANOMIM:192340 : Diabetes insipidus, neurohypophyseal
OMIM:125700 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a NH domain which could be assigned to a KEGG orthologous group, and not all proteins containing NH domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfamhormone5
PROSITENH_DOMAIN
InterProIPR000981