The G_alpha domain within your query sequence starts at position 19 and ends at position 358, and its E-value is 1.24e-216.

All catalytic sites are present in this domain, and marked green in the sequence below. Check the literature (PubMed 94353239 ) for details.

RRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNL
G_alpha

G_alpha

G protein alpha subunit
SMART ACC:SM000275
Description:Subunit of G proteins that contains the guanine nucleotide binding site
InterPro ACC:IPR001019
InterPro abstract:

This family consists of the G protein alpha subunit, which acts as a weak GTPase. G protein classes are defined based on the sequence and function of their alpha subunits, which in mammals fall into four main categories: G alpha-S ( IPR000367 ), G alpha-Q ( IPR000654 expand

GO process:G protein-coupled receptor signaling pathway (GO:0007186)
GO function:G-protein beta/gamma-subunit complex binding (GO:0031683), guanyl nucleotide binding (GO:0019001), GTPase activity (GO:0003924)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 12 497 G_alpha domains in 12 485 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing G_alpha domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing G_alpha domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the G_alpha domain.

ProteinDescriptionDisease / phenotype
GNAS2_HUMANOMIM:139320 : Pseudohypoparathyroidism, type Ia
OMIM:103580 : McCune-Albright polyostotic fibrous dysplasia
OMIM:174800 : Somatotrophinoma ; Pituitary ACTH secreting adenoma
GNAT1_HUMANOMIM:139330 : Night blindness, congenital stationary

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a G_alpha domain which could be assigned to a KEGG orthologous group, and not all proteins containing G_alpha domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamG-alpha
InterProIPR001019