The DM domain within your query sequence starts at position 38 and ends at position 91, and its E-value is 6.53e-21.

RSPTCARCRNHGVTAHLKGHKRLCLFQACECHKCVLILERRRVMAAQVALRRQQ
DM

DM

Doublesex DNA-binding motif
SMART ACC:SM000301
Description: -
InterPro ACC:IPR001275
InterPro abstract:

DMRT genes encode a conserved family of transcription factors that share a unique DNA binding motif, the DM domain [ PUBMED:28774758 ]. This domain was first discovered in the doublesex proteins of Drosophila melanogaster [ PUBMED:9490411 ]. … expand

GO process:regulation of DNA-templated transcription (GO:0006355)
GO function:sequence-specific DNA binding (GO:0043565)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 225 DM domains in 3 008 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DM domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DM domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the DM domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DM domain which could be assigned to a KEGG orthologous group, and not all proteins containing DM domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001275
PfamDM-domain