The E2F_TDP domain within your query sequence starts at position 170 and ends at position 235, and its E-value is 3.53e-35.

RYDTSLGLLTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMG
E2F_TDP

E2F_TDP

E2F/DP family winged-helix DNA-binding domain
SMART ACC:SM001372
Description:This family contains the transcription factor E2F and its dimerization partners TDP1 and TDP2, which stimulate E2F-dependent transcription. E2F binds to DNA as a homodimer or as a heterodimer in association with TDP1/2, the heterodimer having increased binding efficiency. The crystal structure of an E2F4-DP2-DNA complex shows that the DNA-binding domains of the E2F and DP proteins both have a fold related to the winged-helix DNA-binding motif. Recognition of the central c/gGCGCg/c sequence of the consensus DNA-binding site is symmetric, and amino acids that contact these bases are conserved among all known E2F and DP proteins.
InterPro ACC:IPR003316
InterPro abstract:

This entry represents the DNA-binding domain of the E2F and DP proteins, which have a fold related to the winged-helix DNA-binding motif [ PUBMED:10090723 ]. The mammalian transcription factor E2F plays an important role in regulating the expression of genes that are required for passage through the cell cycle. Multiple … expand

GO process:regulation of DNA-templated transcription (GO:0006355)
GO component:transcription regulator complex (GO:0005667)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 7 934 E2F_TDP domains in 6 713 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing E2F_TDP domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing E2F_TDP domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription

Relevant references for this domain

Primary literature for the E2F_TDP domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a E2F_TDP domain which could be assigned to a KEGG orthologous group, and not all proteins containing E2F_TDP domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamE2F_TDP
InterProIPR003316