The Mab-21 domain within your query sequence starts at position 161 and ends at position 501, and its E-value is 1.58e-72.

SAYEQHKIRRPDSFDVLVPLRLPPQVALEPRSLGTEPSLTPAFRSCFVCALKAPPSPSGASTGQWHRDCKPFAEGFCVDVQGRRHLSATLVLRWFQAHLQRSLATVRYSLEGRCRVSLTPGSLEQPPTLHILPCRTDYGCCRLSMAVRLIPAVHLGDGVFLVAPPPPPSPSGALSELPGGLRAEALWGVNTARQEQKLLGWLQERAPPGACYLKCLQLLKALRDLGARGLDPMAATHWGRILSSYVLKTAVLEVLLNEGSPTPSWDEAHLSECLEKLVKFLRDCLLRRRDLFHCVLGPTGAAAEVGPLPKVLREAAPVDLLAPFDPHSRELAAARLLSTWR
Mab-21

Mab-21

SMART ACC:SM001265
Description:This family contains Mab-21 and Mab-21 like proteins. In C. elegans these proteins are required for several aspects of embryonic development (PUBMED:8582275); (PUBMED:15385160).
InterPro ACC:IPR024810
InterPro abstract:

This protein family includes Mab-21 and Mab-21-like (MAB21L) proteins, and the homologues cyclic GMP-AMP synthase-like receptors (cGLRs). MAB21L are putative nucleotidyltransferases required for several aspects of embryonic development including normal development of the eye [ PUBMED:27103078 PUBMED:30487245 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 197 Mab-21 domains in 5 185 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Mab-21 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Mab-21 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Mab-21 domain which could be assigned to a KEGG orthologous group, and not all proteins containing Mab-21 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR024810
PfamMab-21