The INB domain within your query sequence starts at position 35 and ends at position 463, and its E-value is 1.18e-284.

SCEECLLIHPKCAWCSKEYFGNPRSITSRCDLKANLIRNGCEGEIESPASSTHVLRNLPLSSKGSSATGSDVIQMTPQEIAVSLRPGEQTTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLENIRSLGTKLAEEMRKLTSNFRLGFGSFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVSRNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQCHLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEILHGDSKNIIQLIINAYSSIRAKVELSVWDQPEDLNLFFTATCQDGISYPGQRKCEGLKIGDTASFEVSVEARSCPGRQAAQSFTLRPVGFRDSLQVEVAYNCTC
INB

INB

Integrin beta subunits (N-terminal portion of extracellular region)
SMART ACC:SM000187
Description:Portion of beta integrins that lies N-terminal to their EGF-like repeats. Integrins are cell adhesion molecules that mediate cell-extracellular matrix and cell-cell interactions. They contain both alpha and beta subunits. Beta integrins are proposed to have a von Willebrand factor type-A "insert" or "I" -like domain (although this remains to be confirmed).
InterPro ACC:IPR002369
InterPro abstract:

This domain corresponds to the integrin beta VWA domain.

Integrin beta subunits consist of an extracellular domain with a head region, a stalk/leg section, a transmembrane domain, and a cytoplasmic tail. The head region contains a β-I-like domain inserted into a hybrid domain, connected to a plexin-semaphorin-integrin (PSI) [ IPR033760 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 366 INB domains in 4 356 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing INB domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing INB domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the INB domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the INB domain.

ProteinDescriptionDisease / phenotype
ITB3_HUMANOMIM:173470 : Glanzmann thrombasthenia, type B
ITB4_HUMANOMIM:147557 : Epidermolysis bullosa, junctional, with pyloric atresia
OMIM:226730 : Epidermolysis bullosa, generalized atrophic benign
OMIM:226650 : no description
ITB2_HUMANOMIM:600065 : Leukocyte adhesion deficiency
OMIM:116920 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a INB domain which could be assigned to a KEGG orthologous group, and not all proteins containing INB domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEINB_DOMAIN
InterProIPR002369
Pfamintegrin_B