The PSI domain within your query sequence starts at position 1005 and ends at position 1073, and its E-value is 7.82e-1.

SCGGFLTCHECLQSHECGWCGNEDNPTLGRCLQGDFSGPLGGGNCSLWVGEGLGLPVALPARWAYARCP
PSI

PSI

domain found in Plexins, Semaphorins and Integrins
SMART ACC:SM000423
Description: -
InterPro ACC:IPR016201
InterPro abstract:

This domain is found in several different extracellular receptors, including plexins, which are involved in the development of neural and epithelial tissues [ PUBMED:17855350 ]; in semaphorins, which regulate axon guidance, immune function and angiogenesis [ PUBMED:12958590 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 31 672 PSI domains in 20 788 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PSI domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PSI domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the PSI domain.

ProteinDescriptionDisease / phenotype
ITB3_HUMANOMIM:173470 : Glanzmann thrombasthenia, type B
ITB4_HUMANOMIM:147557 : Epidermolysis bullosa, junctional, with pyloric atresia
OMIM:226730 : Epidermolysis bullosa, generalized atrophic benign
OMIM:226650 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PSI domain which could be assigned to a KEGG orthologous group, and not all proteins containing PSI domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR016201