The PDGF domain within your query sequence starts at position 249 and ends at position 339, and its E-value is 3.62e-3.

SCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRKVTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVC
PDGF

PDGF

Platelet-derived and vascular endothelial growth factors (PDGF, VEGF) family
SMART ACC:SM000141
Description:Platelet-derived growth factor is a potent activator for cells of mesenchymal origin. PDGF-A and PDGF-B form AA and BB homodimers and an AB heterodimer. Members of the VEGF family are homologues of PDGF.
InterPro ACC:IPR000072
InterPro abstract:

Platelet-derived growth factor (PDGF) [ PUBMED:2546599 PUBMED:1425569 PUBMED:7640655 ] is a potent mitogen for cells of mesenchymal origin, including smooth muscle cells … expand

GO component:membrane (GO:0016020)
GO function:growth factor activity (GO:0008083)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 492 PDGF domains in 4 490 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PDGF domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PDGF domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the PDGF domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PDGF domain which could be assigned to a KEGG orthologous group, and not all proteins containing PDGF domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEPDGF_DOMAIN
InterProIPR000072
PfamPDGF