The SEP domain within your query sequence starts at position 178 and ends at position 272, and its E-value is 2.15e-57.

SGQDVHVVLKLWKTGFSLDNGDLRSYQDPSNAQFLESIRRGEVPAELRRLAHGGQVNLDMEDHRDEDFVKPKGAFKAFTGEGQKLGSTAPQVLNT
SEP

SEP

Domain present in Saccharomyces cerevisiae Shp1, Drosophila melanogaster eyes closed gene (eyc), and vertebrate p47.
SMART ACC:SM000553
Description: -
InterPro ACC:IPR012989
InterPro abstract:

The SEP (after shp1, eyc and p47) domain is an eukaryotic domain, which occurs frequently and mainly in single units. Almost all proteins containing a SEP domain are succeeded closely by a UBX domain. The function of the SEP domain is as yet unknown but it has been proposed to act as a reversible competitive inhibitor of the lysosomal cysteine protease cathepsin L [ PUBMED:15029246 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 797 SEP domains in 2 785 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SEP domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SEP domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the SEP domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SEP domain which could be assigned to a KEGG orthologous group, and not all proteins containing SEP domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR012989