The PAC domain within your query sequence starts at position 304 and ends at position 347, and its E-value is 5.56e-9.

SGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEI
PAC

PAC

Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain)
SMART ACC:SM000086
Description:PAC motif occurs C-terminal to a subset of all known PAS motifs. It is proposed to contribute to the PAS domain fold.
InterPro ACC:IPR001610
InterPro abstract:

PAC motifs occur C-terminal to a subset of all known PAS motifs (see IPR000014 ). It is proposed to contribute to the PAS domain fold [ PUBMED:9301332 PUBMED:7756254 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 401 760 PAC domains in 251 051 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PAC domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PAC domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the PAC domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PAC domain which could be assigned to a KEGG orthologous group, and not all proteins containing PAC domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001610