The NRF domain within your query sequence starts at position 24 and ends at position 145, and its E-value is 3.58e-13.

SLKCMQDTDEFLSDLNSLKPKEYALRMYDSVGKLGSNVLTGNVDRLGSYSECLSTRSPKGSFRGQYCKLHILQDGTDYSVGVCVPDSCAEEDVTMMSQLGTLKFRNTSFLEPSLSLFTKDSS
NRF

NRF

N-terminal domain in C. elegans NRF-6 (Nose Resistant to Fluoxetine-4) and NDG-4 (resistant to nordihydroguaiaretic acid-4).
SMART ACC:SM000703
Description:Also present in several other worm and fly proteins.
InterPro ACC:IPR006621
InterPro abstract:

This is the N-terminal domain of Caenorhabditis elegans NRF-6 (Nose Resistant to Fluoxetine-4) and NDG-4 (resistant to nordihydroguaiaretic acid-4) proteins; the domain is also present in several other worm and fly proteins. NRF-6 and NDG-4 are multipass transmembrane proteins which may act together in a complex to function to transport fluoxetine across the hypodermal barrier to the inside of … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 235 NRF domains in 3 202 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing NRF domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing NRF domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the NRF domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a NRF domain which could be assigned to a KEGG orthologous group, and not all proteins containing NRF domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

Links to other resources describing this domain

InterProIPR006621