The XPGI domain within your query sequence starts at position 146 and ends at position 218, and its E-value is 2.22e-34.

SLMGIPYLDAPSEAEASCAALAKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAKKLPIQEFHLSRVLQELGL
XPGI

XPGI

Xeroderma pigmentosum G I-region
SMART ACC:SM000484
Description:domain in nucleases
InterPro ACC:IPR006086
InterPro abstract:

This entry represents a domain found on Xeroderma Pigmentosum Complementation Group G (XPG) protein [ PUBMED:8206890 ]. XPG is a DNA endonuclease involved in DNA excision repair [ PUBMED:8078765 ]. The internal XPG (XPG-I) domain contains many … expand

GO function:nuclease activity (GO:0004518)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 7 650 XPGI domains in 7 639 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing XPGI domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing XPGI domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the XPGI domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the XPGI domain.

ProteinDescriptionDisease / phenotype
ERCC5_HUMANOMIM:133530 : Xeroderma pigmentosum, group G
OMIM:278780 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a XPGI domain which could be assigned to a KEGG orthologous group, and not all proteins containing XPGI domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITE XPG_2
InterProIPR006086
PfamXPG_I