The PP2C_SIG domain within your query sequence starts at position 121 and ends at position 520, and its E-value is 2.56e-1.

SPVEDRQGVATCVQTNGMMFGIFDGHGGHACAQAVSERLFYYMAVSLMSHQTLEQMEEATENMKPLLPILRWLKHPGDSIYKDVTSVHLDHLRVYWQELLDLHMEMGLSIEEALMYSFQRLDSDISLEIQAPLEDEVTRNLSLQVAFSGATACMAHVNGVHLHVANAGDCRAILGVQEENGAWSCLPLTCDHNAWNEAELSRLKREHPESEDRTLIIDDRLLGVLMPCRAFGDVQLKWSKELQRNVLARGFDTEALNIYQFTPPHYYTPPYLTAKPEVTYHRLRRQDKFLVLASDGLWDMLGNEDVVRLVVGHLSKVGRHKPDLDQRPANLGLMQSLLLQRKASGLHAADQNTATHLIRHAIGSNEYGEMEPERLAAMLTLPEDVARMYRDDITVMVVFF
PP2C_SIG

PP2C_SIG

Sigma factor PP2C-like phosphatases
SMART ACC:SM000331
Description: -
InterPro ACC:IPR001932
InterPro abstract:

Protein phosphatases remove phosphate groups from various proteins that are the key components of a number of signalling pathways in eukaryotes and prokaryotes. Protein phosphatases that dephosphorylate Ser and Thr residues are classified into the phosphoprotein (PPP) and the protein phosphatase Mg2- or Mn2-dependent (PPM) families. The core structure of PPMs is the 300-residue PPM-type phosphatase … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 114 813 PP2C_SIG domains in 114 809 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PP2C_SIG domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PP2C_SIG domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PP2C_SIG domain which could be assigned to a KEGG orthologous group, and not all proteins containing PP2C_SIG domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001932