The Grip domain within your query sequence starts at position 1608 and ends at position 1655, and its E-value is 4.37e-19.

SVANLEYLKNVLLRFIFLKPGSERERLLPVIDTMLQLSPEEKGKLATV
Grip

Grip

golgin-97, RanBP2alpha,Imh1p and p230/golgin-245
SMART ACC:SM000755
Description: -
InterPro ACC:IPR000237
InterPro abstract:

The GRIP (golgin-97, RanBP2alpha,Imh1p and p230/golgin-245) domain [ PUBMED:10209120 PUBMED:10209123 PUBMED:10209125 ] is found in many large coiled-coil proteins. … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 004 Grip domains in 2 002 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Grip domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Grip domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the Grip domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Grip domain which could be assigned to a KEGG orthologous group, and not all proteins containing Grip domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamGRIP domain
InterProIPR000237