The CK_II_beta domain within your query sequence starts at position 29 and ends at position 206, and its E-value is 6.86e-132.

SWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVP
CK_II_beta

CK_II_beta

Casein kinase II regulatory subunit
SMART ACC:SM001085
Description: -
InterPro ACC:IPR000704
InterPro abstract:

Casein kinase, a ubiquitous well-conserved protein kinase involved in cell metabolism and differentiation, is characterised by its preference for Ser or Thr in acidic stretches of amino acids. The enzyme is a tetramer of 2 alpha-and 2 beta-subunits [ PUBMED:2666134 PUBMED:1856204 expand

GO component:protein kinase CK2 complex (GO:0005956)
GO function:protein kinase regulator activity (GO:0019887)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 104 CK_II_beta domains in 3 099 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CK_II_beta domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CK_II_beta domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CK_II_beta domain which could be assigned to a KEGG orthologous group, and not all proteins containing CK_II_beta domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000704
PfamCK_II_beta