The LCCL domain within your query sequence starts at position 385 and ends at position 477, and its E-value is 1.28e-51.

TAVDCHATVAQLCPFEKPATHCPRIQCPARCGEEPSYWAPVYGTNIYADTSSICKAAVHAGVIVDEVGGYADVMPVDKKKSYVGSLRNGVQSE
LCCL

LCCL

SMART ACC:SM000603
Description: -
InterPro ACC:IPR004043
InterPro abstract:

The LCCL domain has been named after the best characterised proteins that were found to contain it, namely Limulus factor C, Coch-5b2 and Lgl1. It is an about 100 amino acids domain whose C-terminal part contains a highly conserved histidine in a conserved motif YxxxSxxCxAAVHxGVI. The LCCL module is thought to be an autonomously folding domain that has been used for the construction of various … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 753 LCCL domains in 1 821 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing LCCL domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing LCCL domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the LCCL domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a LCCL domain which could be assigned to a KEGG orthologous group, and not all proteins containing LCCL domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR004043