The LYZ1 domain within your query sequence starts at position 21 and ends at position 141, and its E-value is 3.77e-70.

Some of the required catalytic sites were not detected in this domain, and are marked red in the sequence below. The domain is probably inactive. Check the literature (PubMed 505221 ) for details.

Catalytic residues
Position
DomainProteinAmino acidPresent?
3353ENo
4969DNo
TELTKCKVSHAIKDIDGYQGISLLEWACVLFHTSGYDTQAVVNDNGSTEYGLFQISDRFWCKSSEFPESENICGISCDKLLDDELDDDIACAKKILAIKGIDYWKAYKPMCSEKLEQWRCE
LYZ1

LYZ1

Alpha-lactalbumin / lysozyme C
SMART ACC:SM000263
Description: -
InterPro ACC:IPR001916
InterPro abstract:

Glycoside hydrolase family 22 comprises enzymes with two known activities; lysozyme type C ( EC:3.2.1.17 ) (also known as 1, 4-beta-N-acetylmuramidase or LYZ) and alpha-lactalbumins (also known as lactose synthase B protein or LA). Asp and/or the carbonyl oxygen of the C-2 acetamido group of the substrate acts as the catalytic … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 162 LYZ1 domains in 2 862 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing LYZ1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing LYZ1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the LYZ1 domain.

ProteinDescriptionDisease / phenotype
LYSC_HUMANOMIM:153450 : Amyloidosis, renal
OMIM:105200 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a LYZ1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing LYZ1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEPS00128
InterProIPR001916