The CAMSAP_CKK domain within your query sequence starts at position 1442 and ends at position 1570, and its E-value is 3.6e-85.

TGPKLFKEPSSKSNKPIIHNAISHCCLAGKVNEPHKNSILELEKCDANHYIILFRDAGCQFRALYCYQPDTEEIYKLTGTGPKSITKKMIDKLYKYSSDRKQFNLIPAKTMSVSVDALTIHNHLWQPKR
CAMSAP_CKK

CAMSAP_CKK

Microtubule-binding calmodulin-regulated spectrin-associated
SMART ACC:SM001051
Description:This is the C-terminal domain of a family of eumetazoan proteins collectively defined as calmodulin-regulated spectrin-associated, or CAMSAP, proteins. CAMSAP proteins carry an N-terminal region that includes the CH domain, a central region including a predicted coiled-coil and this C-terminal, or CKK, domain - defined as being present in CAMSAP, KIAA1078 and KIAA1543, The C-terminal domain is the part of the CAMSAP proteins that binds to microtubules. The domain appears to act by producing inhibition of neurite extension, probably by blocking microtubule function. CKK represents a domain that has evolved with the metazoa. The structure of a murine hypothetical protein from RIKEN cDNA has shown the domain to adopt a mainly beta barrel structure with an associated alpha-helical hairpin.
InterPro ACC:IPR014797
InterPro abstract:

The CKK domain occurs at the C-terminal in CAMSAP proteins. The structure of the CKK domain is a β-barrel with an associated α-helical hairpin. Characteristically, the CKK domain has a single invariant tryptophan residue within the core of the predicted β-barrel. Residues that interact with this Trp to form part of this core are highly conserved too.

The calmodulin-regulated spectrin-associated … expand

GO function:microtubule binding (GO:0008017)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 587 CAMSAP_CKK domains in 2 585 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CAMSAP_CKK domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CAMSAP_CKK domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the CAMSAP_CKK domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CAMSAP_CKK domain which could be assigned to a KEGG orthologous group, and not all proteins containing CAMSAP_CKK domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR014797
PfamCAMSAP_CKK