The DUF1785 domain within your query sequence starts at position 176 and ends at position 228, and its E-value is 2.98e-24.

TPVGRSFFTASEGCSNPLGGGREVWFGFHQSVRPSLWKMMLNIDVSATAFYKA
DUF1785

DUF1785

SMART ACC:SM001163
Description:This region is found in argonaute [(PUBMED:16216572)] proteins and often co-occurs with BAG (SM00264) and Piwi (SM00950).
InterPro ACC:IPR014811
InterPro abstract:

ArgoL1 is a region found in argonaute [ PUBMED:16216572 ] proteins. It normally co-occurs with BAG domain ( IPR003103 ) and Piwi domain ( IPR003165 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 460 DUF1785 domains in 6 418 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DUF1785 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DUF1785 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the DUF1785 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DUF1785 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DUF1785 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamDUF1785
InterProIPR014811