The CoA_trans domain within your query sequence starts at position 301 and ends at position 499, and its E-value is 5.07e-71.

TRIIKRAALEFQDGMYANLGIGIPVLASNYISPKMTVYLHSENGILGLGPFPLKNEVDADVINAGKQTVTVVPGGCFFASDDSFAMIRGGHLQLTMLGAMQVSQYGDLANWMVPGKKVKGMGGAMDLVSSKKTRVVVTMEHCTKTKQPKILKKCTMPLTGKRCVDLIITEKAVFEVNHSKGLTLVELWEGSSVDDIKAT
CoA_trans

CoA_trans

Coenzyme A transferase
SMART ACC:SM000882
Description:Coenzyme A (CoA) transferases belong to an evolutionary conserved family of enzymes catalyzing the reversible transfer of CoA from one carboxylic acid to another. They have been identified in many prokaryotes and in mammalian tissues. The bacterial enzymes are heterodimer of two subunits (A and B) of about 25 Kd each while eukaryotic SCOT consist of a single chain which is colinear with the two bacterial subunits.
InterPro ACC:IPR004165
InterPro abstract:

This family consists of 3-oxoacid CoA-transferases and related CoA-transferases from family I.

Coenzyme A (CoA) transferases belong to an evolutionary conserved [ PUBMED:1624453 PUBMED:9325289 ] family of enzymes catalyzing the reversible … expand

GO function:CoA-transferase activity (GO:0008410)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 43 359 CoA_trans domains in 40 171 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CoA_trans domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CoA_trans domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

Relevant references for this domain

Primary literature for the CoA_trans domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CoA_trans domain which could be assigned to a KEGG orthologous group, and not all proteins containing CoA_trans domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR004165
PfamCoA_trans