The Catalase domain within your query sequence starts at position 28 and ends at position 413, and its E-value is 4.7e-285.

TTGGGNPIGDKLNIMTAGSRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITRYSKAKVFEHIGKRTPIAVRFSTVTGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDAILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNADGEAVYCKFHYKTDQGIKNLPVGEAGRLAQEDPDYGLRDLFNAIANGNYPSWTFYIQVMTFKEAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNKNPVNYFAEVEQMAFDPSNMPPGIEPSPDKMLQGRLFAYPDTHRHRLGPNYLQIPVNCPYRARVANYQRDGPMCMHDNQGGAPNYYPNSFSAPE
Catalase

Catalase

SMART ACC:SM001060
Description:Catalases are antioxidant enzymes that catalyse the conversion of hydrogen peroxide to water and molecular oxygen, serving to protect cells from its toxic effects (PUBMED:11351128). Hydrogen peroxide is produced as a consequence of oxidative cellular metabolism and can be converted to the highly reactive hydroxyl radical via transition metals, this radical being able to damage a wide variety of molecules within a cell, leading to oxidative stress and cell death. Catalases act to neutralise hydrogen peroxide toxicity, and are produced by all aerobic organisms ranging from bacteria to man. Most catalases are mono-functional, haem-containing enzymes, although there are also bifunctional haem-containing peroxidase/catalases that are closely related to plant peroxidases, and non-haem, manganese-containing catalases that are found in bacteria (PUBMED:14745498).
InterPro ACC:IPR011614
InterPro abstract:

Catalases ( EC:1.11.1.6 ) are antioxidant enzymes that catalyse the conversion of hydrogen peroxide to water and molecular oxygen, serving to protect cells from its toxic effects [ PUBMED:11351128 ]. Hydrogen peroxide is produced as a consequence of … expand

GO function:heme binding (GO:0020037), catalase activity (GO:0004096)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 26 181 Catalase domains in 26 155 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Catalase domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Catalase domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Catalase domain which could be assigned to a KEGG orthologous group, and not all proteins containing Catalase domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR011614
PfamCatalase