The TAF domain within your query sequence starts at position 12 and ends at position 78, and its E-value is 1.44e-35.

TVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLK
TAF

TAF

TATA box binding protein associated factor
SMART ACC:SM000803
Description:TAFs (TATA box binding protein associated factors) are part of the transcription initiation factor TFIID multimeric protein complex. TFIID is composed of the TATA box binding protein (TBP) and a number of TAFs. The TAFs provide binding sites for many different transcriptional activators and co-activators that modulate transcription initiation by Pol II. TAF proteins adopt a histone-like fold.
InterPro ACC:IPR004823
InterPro abstract:

The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex. TFIID plays a central role in mediating promoter responses to various activators and repressors. It binds tightly to TAFII-250 and directly interacts with TAFII-40. TFIID is composed of TATA binding protein (TBP) and a number of TBP-associated factors (TAFS). TAF … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 736 TAF domains in 1 726 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing TAF domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing TAF domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription

Relevant references for this domain

Primary literature for the TAF domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a TAF domain which could be assigned to a KEGG orthologous group, and not all proteins containing TAF domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamTAF
InterProIPR004823