The CT domain within your query sequence starts at position 164 and ends at position 246, and its E-value is 1.73e-28.

TVPFNQTIAHEDCQKVVVQNNLCFGKCSSIRFPGEGADAHSFCSHCSPTKFTTVHLMLNCTSPTPVVKMVMQVEECQCMVKTE
CT

CT

C-terminal cystine knot-like domain (CTCK)
SMART ACC:SM000041
Description:The structures of transforming growth factor-beta (TGFbeta), nerve growth factor (NGF), platelet-derived growth factor (PDGF) and gonadotropin all form 2 highly twisted antiparallel pairs of beta-strands and contain three disulphide bonds. The domain is non-globular and little is conserved among these presumed homologues except for their cysteine residues. CT domains are predicted to form homodimers.
InterPro ACC:IPR006207
InterPro abstract:

Four recent crystal structures of growth factors--nerve growth factor, transforming growth factor-beta, platelet-derived growth factor, and human chorionic gonadotropin--from four separate superfamilies revealed that these proteins are structurally related and share a common overall topology [ PUBMED:8490958 ]. These … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 7 744 CT domains in 7 736 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CT domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CT domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the CT domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the CT domain.

ProteinDescriptionDisease / phenotype
NDP_HUMANOMIM:310600 : Norrie disease ; Exudative vitreoretinopathy, X-linked
OMIM:305390 : Coats disease
OMIM:300216 : no description
VWF_HUMANOMIM:193400 : von Willebrand disease

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CT domain which could be assigned to a KEGG orthologous group, and not all proteins containing CT domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITECT_DOMAIN
InterProIPR006207