The Btz domain within your query sequence starts at position 138 and ends at position 246, and its E-value is 1.02e-57.

TVTGERQSGDGQESTEPVENKVGKKGPKHLDDDEDRKNPAYIPRKGLFFEHDLRGQTQEEEVRPKGRQRKLWKDEGRWEHDKFREDEQAPKSRQELIALYGYDIRSAHN
Btz

Btz

CASC3/Barentsz eIF4AIII binding
SMART ACC:SM001044
Description:This domain is found on CASC3 (cancer susceptibility candidate gene 3 protein) which is also known as Barentsz (Btz). CASC3 is a component of the EJC (exon junction complex) which is a complex that is involved in post-transcriptional regulation of mRNA in metazoa. The complex is formed by the association of four proteins (eIF4AIII, Barentsz, Mago, and Y14), mRNA, and ATP. This domain wraps around eIF4AIII and stacks against the 5' nucleotide (PUBMED:16923391).
InterPro ACC:IPR018545
InterPro abstract:

This domain is found on CASC3 (cancer susceptibility candidate gene 3 protein, also known as MLN51) which is also known as Barentsz (Btz). CASC3 is a component of the EJC (exon junction complex) which is a complex that is involved in post-transcriptional regulation of mRNA in metazoa. The complex is formed by the association of four proteins (eIF4AIII, Barentsz, Mago, and Y14), mRNA, and ATP. … expand

GO process:mRNA processing (GO:0006397)
GO component:exon-exon junction complex (GO:0035145)
GO function:mRNA binding (GO:0003729)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 119 Btz domains in 1 117 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Btz domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Btz domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription

Relevant references for this domain

Primary literature for the Btz domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Btz domain which could be assigned to a KEGG orthologous group, and not all proteins containing Btz domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR018545
PfamBtz