The PEHE domain within your query sequence starts at position 459 and ends at position 577, and its E-value is 2.73e-41.

VAIPSWRDHSVEPLRDPNPSDILENLDDSVFSKRHAKLELDEKRRKRWDIQRIREQRILQRLQLRMYKKKGIQESEPEVTSFFPEPDDVESLLITPFLPVVAFGRPLPKLAPQNFELPW
PEHE

PEHE

SMART ACC:SM001300
Description:This domain was first identified in drosophila MSL1 (male-specific lethal 1) PMID:12698291. In drosophila it binds to the histone acetyltransferase males-absent on the first protein (MOF) and to protein male-specific lethal-3 (MSL3) PMID:15141166;PMID:21217699.
InterPro ACC:IPR029332
InterPro abstract:

This domain was first identified in drosophila MSL1 (male-specific lethal 1) [ PUBMED:12698291 ]. In drosophila it binds to the histone acetyltransferase males-absent on the first protein (MOF) and to protein male-specific lethal-3 (MSL3) [ PUBMED:15141166 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 820 PEHE domains in 1 820 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PEHE domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PEHE domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the PEHE domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PEHE domain which could be assigned to a KEGG orthologous group, and not all proteins containing PEHE domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamPEHE
InterProIPR029332