The FIMAC domain within your query sequence starts at position 773 and ends at position 841, and its E-value is 4.65e-20.

VCGACPIWSKCDAQNGKCICREASECQTAGYRICVEVNGKEETMSECEAGILRCRGQSISITAIKPCAE
FIMAC

FIMAC

factor I membrane attack complex
SMART ACC:SM000057
Description: -
InterPro ACC:IPR003884
InterPro abstract:

This domain is found in complement component proteins, complement component factor 1 and agrin. Complement components C5b, C6, C7 C8 and C9 are the constituents of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells. Its assembly is initiated by protelytic cleavage of C5 into C5a and C5b. C5b … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 701 FIMAC domains in 355 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing FIMAC domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing FIMAC domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the FIMAC domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a FIMAC domain which could be assigned to a KEGG orthologous group, and not all proteins containing FIMAC domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003884