The Beta-TrCP_D domain within your query sequence starts at position 102 and ends at position 141, and its E-value is 3.32e-25.

VKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQ
Beta-TrCP_D

Beta-TrCP_D

D domain of beta-TrCP
SMART ACC:SM001028
Description:This domain is found in eukaryotes, and is approximately 40 amino acids in length. It is found associated with F-box domain, WD domain. The protein that contains this domain functions as a ubiquitin ligase. Ubiquitination is required to direct proteins towards the proteasome for degradation. This protein is part of the WD40 class of F box proteins. The D domain of these F box proteins is involved in mediating the dimerisation of the protein. Dimerisation is necessary to polyubiquitinate substrates so this D domain is vital in directing substrates towards the proteasome for degradation.
InterPro ACC:IPR021977
InterPro abstract:

This entry represents the D domain of beta-TrCP, which is a member of the WD40 class of F box proteins, and functions as a ubiquitin ligase. The D domain of these F box proteins is involved in mediating dimerisation of the protein [ PUBMED:17574027 ]. Dimerisation is necessary to polyubiquitinate substrates, so this … expand

GO function:protein dimerization activity (GO:0046983)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 941 Beta-TrCP_D domains in 938 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Beta-TrCP_D domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Beta-TrCP_D domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Beta-TrCP_D domain which could be assigned to a KEGG orthologous group, and not all proteins containing Beta-TrCP_D domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR021977
PfamBeta-TrCP_D