The GATase_5 domain within your query sequence starts at position 166 and ends at position 468, and its E-value is 6.88e-120.

VPRVAILREEGSNGDREMADAFHLAGFEVWDVTMQDLCSGAIRLDTFRGVAFVGGFSYADVLGSAKGWAAAVTFNPQAREELGRFRRRPDTFSLGVCNGCQLLALLGWVGSDPSEEQAEPGQDSQPTQPGLLLRHNLSGRFESRWATVRVEPGPALMLRGMEGSVLPVWSAHGEGQAGKAGEGLQAGAGAGPEGTWPSLSSPSLPGYMAFSSPELQAKIEAKGLVPLHWADDDGNPTEQYPLNPNGSPGGIAGICSQDGRHLALMPHPERAVRLWQWAWRPSPFDVLPTSPWLQLFINARNWT
GATase_5

GATase_5

CobB/CobQ-like glutamine amidotransferase domain
SMART ACC:SM001211
Description: -
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 21 508 GATase_5 domains in 21 508 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing GATase_5 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing GATase_5 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the GATase_5 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a GATase_5 domain which could be assigned to a KEGG orthologous group, and not all proteins containing GATase_5 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamGATase_5