The DUF1087 domain within your query sequence starts at position 1252 and ends at position 1316, and its E-value is 2.98e-33.

VREEDKIEEIEREIIKQEENVDPDYWEKLLRHHYEQQQEDLARNLGKGKRVRKQVNYNDAAQEDQ
DUF1087

DUF1087

SMART ACC:SM001147
Description:Members of this family are found in various chromatin remodelling factors and transposases. Their exact function is, as yet, unknown.
InterPro ACC:IPR009463
InterPro abstract:

This domain is found in chromatin remodelling factors (CHDs) from subfamily II, including CHD3/4/5 from animals and PICKLE from Arabidopsis [ PUBMED:23128324 ]. The exact function is, as yet, unknown.

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 152 DUF1087 domains in 2 147 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DUF1087 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DUF1087 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transport

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DUF1087 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DUF1087 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamDUF1087
InterProIPR009463