The CactinC_cactus domain within your query sequence starts at position 648 and ends at position 772, and its E-value is 2.13e-87.

WADKYRPRKPRFFNRVHTGFEWNKYNQTHYDFDNPPPKIVQGYKFNIFYPDLIRKRATPEYFLEACADNRDFAILRFHAGPPYEDIAFKIVSREWEYSHRHGFRCQFANGIFQLWFHFKRYRYRR
CactinC_cactus

CactinC_cactus

Cactus-binding C-terminus of cactin protein
SMART ACC:SM001050
Description:CactinC_cactus is the C-terminal 200 residues of the cactin protein which are necessary for the association of cactin with IkappaB-cactus as one of the intracellular members of the Rel complex. The Rel (NF-kappaB) pathway is conserved in invertebrates and vertebrates. In mammals, it controls the activities of the immune and inflammatory response genes as well as viral genes, and is critical for cell growth and survival. In Drosophila, the Rel pathway functions in the innate cellular and humoral immune response, in muscle development, and in the establishment of dorsal-ventral polarity in the early embryo (PUBMED:10842059). Most members of the family also have a Cactin_mid domain further upstream.
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 979 CactinC_cactus domains in 2 978 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CactinC_cactus domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CactinC_cactus domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the CactinC_cactus domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CactinC_cactus domain which could be assigned to a KEGG orthologous group, and not all proteins containing CactinC_cactus domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamCactinC_cactus