The TSP1 domain within your query sequence starts at position 2394 and ends at position 2446, and its E-value is 6.36e-21.

WAEWGPWTACSVSCGGGHQSRQRSCVDPPPKNGGAPCPGPSHEKAPCNLQLCP
TSP1

TSP1

Thrombospondin type 1 repeats
SMART ACC:SM000209
Description:Type 1 repeats in thrombospondin-1 bind and activate TGF-beta.
InterPro ACC:IPR000884
InterPro abstract:

This repeat was first described in 1986 by Lawler and Hynes [ PUBMED:2430973 ]. It was found in the thrombospondin protein where it is repeated 3 times. Now a number of proteins involved in the complement pathway (properdin, C6, C7, C8A, C8B, C9) [ PUBMED:2459396 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 144 158 TSP1 domains in 35 805 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing TSP1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing TSP1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the TSP1 domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the TSP1 domain.

ProteinDescriptionDisease / phenotype
PROP_HUMANOMIM:312060 : Properdin deficiency, X-linked
CO6_HUMANOMIM:217050 : C6 deficiency ; Combined C6/C7 deficiency

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a TSP1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing TSP1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR000884
Pfamtsp_1