The SERPIN domain within your query sequence starts at position 62 and ends at position 205, and its E-value is 1.47e-2.

YDLYRLRSSASPTGNVLLSPLSVATALSALSLELRVKSSFVAPLEKSYGTRPRILTGNPRVDLQEINNWVQAQMKGKIARSTREMPSALSILLLGVAYFKGQWVTKFDSRKTTLQDFHLDEDRTVRVPMMSDPKAILRYGLDSD
SERPIN

SERPIN

SERine Proteinase INhibitors
SMART ACC:SM000093
Description: -
InterPro ACC:IPR023796
InterPro abstract:

This entry represents the structural domain of serpins.

Serpins (SERine Proteinase INhibitors) belong to MEROPS inhibitor family I4, clan ID. Most serpin family members are indeed serine protease inhibitors, but several have additional cross-class inhibition functions and inhibit cysteine protease family members such as the caspases and cathepsins [ PUBMED:8034697 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 21 666 SERPIN domains in 21 322 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SERPIN domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SERPIN domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the SERPIN domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the SERPIN domain.

ProteinDescriptionDisease / phenotype
AACT_HUMANOMIM:107280 : Alpha-1-antichymotrypsin deficiency ; Cerebrovascular disease, occlusive
ANGT_HUMANOMIM:106150 : {Hypertension, essential, susceptibility to} ; {Preeclampsia, susceptibility to}
NEUS_HUMANOMIM:602445 : Encephalopathy, familial, with neuroserpin inclusion bodies
OMIM:604218 : no description
ANT3_HUMANOMIM:107300 : Antithrombin III deficiency
THBG_HUMANOMIM:314200 : THYROXINE-BINDING GLOBULIN OF SERUM; TBG
HEP2_HUMANOMIM:142360 : Thrombophilia due to heparin cofactor II deficiency
IC1_HUMANOMIM:106100 : Angioedema, hereditary
IPSP_HUMANOMIM:601841 : Protein C inhibitor deficiency
A1AT_HUMANOMIM:107400 : Emphysema-cirrhosis ; Hemorrhagic diathesis due to `antithrombin' Pittsburgh ; Emphysema

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SERPIN domain which could be assigned to a KEGG orthologous group, and not all proteins containing SERPIN domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEPS00284
InterProIPR023796