The FU domain within your query sequence starts at position 1034 and ends at position 1079, and its E-value is 5.04e-10.

YEECMPCEEGCLGCTEDDPGACTSCATGYYMFERHCYKACPEKTFG
FU

FU

Furin-like repeats
SMART ACC:SM000261
Description: -
InterPro ACC:IPR006212
InterPro abstract:

The furin-like cysteine rich region has been found in a variety of proteins from eukaryotes that are involved in the mechanism of signal transduction by receptor tyrosine kinases, which involves receptor aggregation [ PUBMED:1936959 PUBMED:23756652 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 66 474 FU domains in 13 497 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing FU domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing FU domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the FU domain.

ProteinDescriptionDisease / phenotype
INSR_HUMANOMIM:147670 : Leprechaunism
OMIM:246200 : Rabson-Mendenhall syndrome
OMIM:262190 : Diabetes mellitus, insulin-resistant, with acanthosis nigricans

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a FU domain which could be assigned to a KEGG orthologous group, and not all proteins containing FU domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006212
PfamFurin-like