The Endonuclease_NS domain within your query sequence starts at position 661 and ends at position 892, and its E-value is 3.93e-36.

YHTDFESGYSEIFLMPLWTSYTISKQAEVSSIPEHLTNCVRPDVRVSPGFSQNCLAYKNDKQMSYGFLFPPYLSSSPEAKYDAFLVTNMVPMYPAFKRVWTYFQRVLVKKYASERNGVNVISGPIFDYNYNGLRDIEDEIKQYVEGSSIPVPTHYYSIITSCLDFTQPADKCDGPLSVSSFILPHRPDNDESCNSSEDESKWVEELMKMHTARVRDIEHLTGLDFYRKTSRS

Endonuclease_NS DNA/RNA non-specific endonuclease
SMART ACC:	SM000892
Description:	A family of bacterial and eukaryotic endonucleases share the following characteristics: they act on both DNA and RNA, cleave double-stranded and single-stranded nucleic acids and require a divalent ion such as magnesium for their activity. An histidine has been shown to be essential for the activity of the Serratia marcescens nuclease. This residue is located in a conserved region which also contains an aspartic acid residue that could be implicated in the binding of the divalent ion.
InterPro ACC:	IPR001604
InterPro abstract:	This entry represents a domain found in a group of DNA/RNA non-specific endonucleases ( EC:3.1.30 ) and nucleotide pyrophosphatase/phosphodiesterases from eukaryotes and bacteria, including human Endonuclease G, mitochondrial [ PUBMED:25355512 expand This entry represents a domain found in a group of DNA/RNA non-specific endonucleases ( EC:3.1.30 ) and nucleotide pyrophosphatase/phosphodiesterases from eukaryotes and bacteria, including human Endonuclease G, mitochondrial [ PUBMED:25355512 PUBMED:29719607 PUBMED:33473107 ] and Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 [ PUBMED:25344812 PUBMED:28011303 PUBMED:35147247 ]. A family of bacterial and eukaryotic endonucleases EC:3.1.30 share the following characteristics: they act on both DNA and RNA, cleave double-stranded and single-stranded nucleic acids and require a divalent ion such as magnesium for their activity. A histidine has been shown [ PUBMED:8078761 ] to be essential for the activity of the Serratia marcescens nuclease. This residue is located in a conserved region which also contains an aspartic acid residue that could be implicated in the binding of the divalent ion. This entry also includes Salivary proteins Tsal1 and Tsal2A, both high affinity nucleic acid binding proteins with residual nuclease activity and with a preference for dsDNA in a broad pH range[ PUBMED:23110062 ]. collapse
GO function:	hydrolase activity (GO:0016787), metal ion binding (GO:0046872), nucleic acid binding (GO:0003676)
Family alignment:	View the Family alignment or the Alignment consensus sequence
There are 13 023 Endonuclease_NS domains in 12 891 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Endonuclease_NS domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Endonuclease_NS domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:	Transport

Relevant references for this domain

Primary literature for the Endonuclease_NS domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Endonuclease_NS domain which could be assigned to a KEGG orthologous group, and not all proteins containing Endonuclease_NS domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterPro	IPR001604
Pfam	Endonuclease_NS