The CoA_binding domain within your query sequence starts at position 51 and ends at position 147, and its E-value is 6.28e-35.

YIDKNTKIICQGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGQKHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAINEAIDAEIPLVVCITEGI
CoA_binding

CoA_binding

CoA binding domain
SMART ACC:SM000881
Description:This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases.
InterPro ACC:IPR003781
InterPro abstract:

This domain has a Rossmann fold and is found in a number of proteins including bacterial Redox-sensing transcriptional repressor Rex [ PUBMED:15642260 ], succinyl CoA synthetases [ PUBMED:11781092 ], malate and ATP-citrate ligases [ expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 47 705 CoA_binding domains in 47 704 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CoA_binding domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CoA_binding domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

Relevant references for this domain

Primary literature for the CoA_binding domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CoA_binding domain which could be assigned to a KEGG orthologous group, and not all proteins containing CoA_binding domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamCoA_binding
InterProIPR003781