The HELICc domain within your query sequence starts at position 290 and ends at position 434, and its E-value is 1.32e-76.

YQYMESTVASWYEQGILENIQRNKLLFIETQDGAETSVALEKYQEACENGRGAILLSVARGKVSEGIDFVHHYGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMVFADKRFAR
HELICc

HELICc

helicase superfamily c-terminal domain
SMART ACC:SM000490
Description: -
InterPro ACC:IPR001650
InterPro abstract:

Helicases have been classified in 5 superfamilies (SF1-SF5). For the two largest groups, commonly referred to as SF1 and SF2, a total of seven characteristic motifs has been identified [ PUBMED:2546125 ]. These two superfamilies encompass a large number of DNA and RNA helicases from archaea, eubacteria, eukaryotes and … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 429 775 HELICc domains in 427 751 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing HELICc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing HELICc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the HELICc domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the HELICc domain.

ProteinDescriptionDisease / phenotype
ATRX_HUMANOMIM:300032 : Alpha-thalassemia/mental retardation syndrome
OMIM:301040 : Juberg-Marsidi syndrome
OMIM:309590 : Sutherland-Haan syndrome
OMIM:309470 : Smith-Fineman-Myers syndrome
OMIM:309580 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a HELICc domain which could be assigned to a KEGG orthologous group, and not all proteins containing HELICc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001650
Pfamhelicase_C