The MACPF domain within your query sequence starts at position 89 and ends at position 281, and its E-value is 6.58e-50.

YREFARWKVNNLALERRDFFSLPLPLAPEFVRNIRLLGRRPNLQQVTENLIKKYGTHFLLSATLGGEESLTIFVDKRKLSRKSETTGGIPVVGGTGNSSAVSLETLHQLAASYFIDRESTLRRLHHIQIATGAIKVTETRTGPLGCSNYDNLDSVSSVLVQSPENKVQLLGLQVLLPEHLRERFVAAALSYIT
MACPF

MACPF

membrane-attack complex / perforin
SMART ACC:SM000457
Description: -
InterPro ACC:IPR020864
InterPro abstract:

The membrane attack complex/perforin (MACPF) domain is conserved in bacteria, fungi, mammals and plants. It was originally identified and named as being common to five complement components (C6, C7, C8-alpha, C8-beta, and C9) and perforin. These molecules perform critical functions in innate and adaptive immunity. The MAC family proteins and perforin are known to participate in lytic pore formation. … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 546 MACPF domains in 3 539 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing MACPF domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing MACPF domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the MACPF domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the MACPF domain.

ProteinDescriptionDisease / phenotype
PERF_HUMANOMIM:170280 : Hemophagocytic lymphohistiocytosis, familial, 2
OMIM:603553 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a MACPF domain which could be assigned to a KEGG orthologous group, and not all proteins containing MACPF domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEMAC_PERFORIN
InterProIPR020864