The B5 domain within your query sequence starts at position 304 and ends at position 374, and its E-value is 6.31e-17.

YRKEMVRADLINKKVGIRETPANLAKLLTRMCLKSEVIGDGNQIEVEIPPTRADVIHACDIVEDAAIAYGY
B5

B5

tRNA synthetase B5 domain
SMART ACC:SM000874
Description:This domain is found in phenylalanine-tRNA synthetase beta subunits.
InterPro ACC:IPR005147
InterPro abstract:

Domain B5 is found in phenylalanine-tRNA synthetase beta subunits. This domain has been shown to bind DNA through a winged helix-turn-helix motif [ PUBMED:11152603 ]. Phenylalanine-tRNA synthetase may influence common cellular processes via DNA binding, in addition to its aminoacylation function.

GO process:phenylalanyl-tRNA aminoacylation (GO:0006432)
GO function:ATP binding (GO:0005524), RNA binding (GO:0003723), magnesium ion binding (GO:0000287)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 25 344 B5 domains in 25 284 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing B5 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing B5 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Translation

Relevant references for this domain

Primary literature for the B5 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a B5 domain which could be assigned to a KEGG orthologous group, and not all proteins containing B5 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR005147
PfamB5